Lineage for d2juza1 (2juz A:1-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739155Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 2739156Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 2739157Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 2739168Protein Uncharacterized protein HI0840 [158655] (1 species)
  7. 2739169Species Haemophilus influenzae [TaxId:727] [158656] (1 PDB entry)
    Uniprot P44897 1-72
  8. 2739170Domain d2juza1: 2juz A:1-72 [148219]
    Other proteins in same PDB: d2juza2, d2juzb3

Details for d2juza1

PDB Entry: 2juz (more details)

PDB Description: Solution NMR structure of HI0947 from Haemophilus influenzae, Northeast Structural Genomics Consortium Target IR123
PDB Compounds: (A:) UPF0352 protein HI0840

SCOPe Domain Sequences for d2juza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2juza1 a.284.1.1 (A:1-72) Uncharacterized protein HI0840 {Haemophilus influenzae [TaxId: 727]}
maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa
fsnslinavktr

SCOPe Domain Coordinates for d2juza1:

Click to download the PDB-style file with coordinates for d2juza1.
(The format of our PDB-style files is described here.)

Timeline for d2juza1:

2739170
d2juza1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2juza2