Lineage for d2jssa1 (2jss A:96-192)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262431Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1262432Protein Histone H2A [47115] (6 species)
  7. 1262504Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (2 PDB entries)
  8. 1262507Domain d2jssa1: 2jss A:96-192 [148192]
    Other proteins in same PDB: d2jssa2
    automatically matched to d1id3c_

Details for d2jssa1

PDB Entry: 2jss (more details)

PDB Description: nmr structure of chaperone chz1 complexed with histone h2a.z-h2b
PDB Compounds: (A:) Chimera of Histone H2B.1 and Histone H2A.Z

SCOPe Domain Sequences for d2jssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jssa1 a.22.1.1 (A:96-192) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId: 4932]}
qsssaraglqfpvgrikrylkrhatgrtrvgskaaiyltavleyltaevlelagnaakdl
kvkritprhlqlairgddeldsliratiasggvlphi

SCOPe Domain Coordinates for d2jssa1:

Click to download the PDB-style file with coordinates for d2jssa1.
(The format of our PDB-style files is described here.)

Timeline for d2jssa1:

1262507
d2jssa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2jssa2