| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (7 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (2 PDB entries) |
| Domain d2jssa1: 2jss A:96-192 [148192] Other proteins in same PDB: d2jssa2 automatically matched to d1id3c_ |
PDB Entry: 2jss (more details)
SCOPe Domain Sequences for d2jssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jssa1 a.22.1.1 (A:96-192) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId: 4932]}
qsssaraglqfpvgrikrylkrhatgrtrvgskaaiyltavleyltaevlelagnaakdl
kvkritprhlqlairgddeldsliratiasggvlphi
Timeline for d2jssa1: