Lineage for d2jrxa1 (2jrx A:1-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739155Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 2739156Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 2739157Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 2739177Protein Uncharacterized protein YejL [158659] (1 species)
  7. 2739178Species Escherichia coli [TaxId:562] [158660] (1 PDB entry)
    Uniprot P0AD24 1-75
  8. 2739179Domain d2jrxa1: 2jrx A:1-75 [148187]
    Other proteins in same PDB: d2jrxa2, d2jrxb3

Details for d2jrxa1

PDB Entry: 2jrx (more details)

PDB Description: solution nmr structure of protein yejl from e. coli. northeast structural genomics target er309
PDB Compounds: (A:) UPF0352 protein yejL

SCOPe Domain Sequences for d2jrxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jrxa1 a.284.1.1 (A:1-75) Uncharacterized protein YejL {Escherichia coli [TaxId: 562]}
mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
faralqssinedkah

SCOPe Domain Coordinates for d2jrxa1:

Click to download the PDB-style file with coordinates for d2jrxa1.
(The format of our PDB-style files is described here.)

Timeline for d2jrxa1:

2739179
d2jrxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2jrxa2