Lineage for d2jr5a_ (2jr5 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754038Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. 1754039Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. 1754044Family a.218.1.0: automated matches [254244] (1 protein)
    not a true family
  6. 1754045Protein automated matches [254560] (2 species)
    not a true protein
  7. 1754050Species Vibrio cholerae [TaxId:666] [255289] (1 PDB entry)
  8. 1754051Domain d2jr5a_: 2jr5 A: [242267]
    automated match to d1puza_

Details for d2jr5a_

PDB Entry: 2jr5 (more details)

PDB Description: solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
PDB Compounds: (A:) UPF0350 protein VC_2471

SCOPe Domain Sequences for d2jr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jr5a_ a.218.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mytaeqkarikwacrrgmleldvvimpffeecfdslteseqddfvallesddpdlfawvm
ghgrcenlglaamvdkivahnlskvrlehhhhhh

SCOPe Domain Coordinates for d2jr5a_:

Click to download the PDB-style file with coordinates for d2jr5a_.
(The format of our PDB-style files is described here.)

Timeline for d2jr5a_: