![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.0: automated matches [191613] (1 protein) not a true family |
![]() | Protein automated matches [191119] (7 species) not a true protein |
![]() | Species Malayan krait (Bungarus candidus) [TaxId:92438] [255287] (1 PDB entry) |
![]() | Domain d2jqpa_: 2jqp A: [242265] automated match to d1ff4a_ |
PDB Entry: 2jqp (more details)
SCOPe Domain Sequences for d2jqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jqpa_ g.7.1.0 (A:) automated matches {Malayan krait (Bungarus candidus) [TaxId: 92438]} ltclicpekdcqkvhtcrneekicvkrfydknqlgwraqrgcavscpkakpnetvqccst dkcnk
Timeline for d2jqpa_: