Lineage for d2jqpa_ (2jqp A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637241Family g.7.1.0: automated matches [191613] (1 protein)
    not a true family
  6. 2637242Protein automated matches [191119] (7 species)
    not a true protein
  7. 2637262Species Malayan krait (Bungarus candidus) [TaxId:92438] [255287] (1 PDB entry)
  8. 2637263Domain d2jqpa_: 2jqp A: [242265]
    automated match to d1ff4a_

Details for d2jqpa_

PDB Entry: 2jqp (more details)

PDB Description: NMR structure determination of Bungatoxin from Bungarus candidus (Malayan Krait)
PDB Compounds: (A:) Weak toxin 1

SCOPe Domain Sequences for d2jqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqpa_ g.7.1.0 (A:) automated matches {Malayan krait (Bungarus candidus) [TaxId: 92438]}
ltclicpekdcqkvhtcrneekicvkrfydknqlgwraqrgcavscpkakpnetvqccst
dkcnk

SCOPe Domain Coordinates for d2jqpa_:

Click to download the PDB-style file with coordinates for d2jqpa_.
(The format of our PDB-style files is described here.)

Timeline for d2jqpa_: