Lineage for d2jq4a1 (2jq4 A:1-83)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266819Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1266866Protein Hypothetical protein Atu2571 [158427] (1 species)
  7. 1266867Species Agrobacterium tumefaciens [TaxId:358] [158428] (1 PDB entry)
    Uniprot Q8UCC7 1-83
  8. 1266868Domain d2jq4a1: 2jq4 A:1-83 [148170]

Details for d2jq4a1

PDB Entry: 2jq4 (more details)

PDB Description: complete resonance assignments and solution structure calculation of atc2521 (nesg id: att6) from agrobacterium tumefaciens
PDB Compounds: (A:) Hypothetical protein Atu2571

SCOPe Domain Sequences for d2jq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]}
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvklildgkeaa

SCOPe Domain Coordinates for d2jq4a1:

Click to download the PDB-style file with coordinates for d2jq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jq4a1: