Lineage for d2jq4a1 (2jq4 A:1-83)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767347Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 767348Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 767349Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (6 proteins)
  6. 767391Protein Hypothetical protein Atu2571 [158427] (1 species)
  7. 767392Species Agrobacterium tumefaciens [TaxId:358] [158428] (1 PDB entry)
    Uniprot Q8UCC7 1-83
  8. 767393Domain d2jq4a1: 2jq4 A:1-83 [148170]

Details for d2jq4a1

PDB Entry: 2jq4 (more details)

PDB Description: complete resonance assignments and solution structure calculation of atc2521 (nesg id: att6) from agrobacterium tumefaciens
PDB Compounds: (A:) Hypothetical protein Atu2571

SCOP Domain Sequences for d2jq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]}
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvklildgkeaa

SCOP Domain Coordinates for d2jq4a1:

Click to download the PDB-style file with coordinates for d2jq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jq4a1: