Lineage for d2jppa_ (2jpp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825104Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2825105Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2825106Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 2825114Protein automated matches [190528] (4 species)
    not a true protein
  7. 2825124Species Pseudomonas fluorescens [TaxId:294] [255284] (6 PDB entries)
  8. 2825133Domain d2jppa_: 2jpp A: [242260]
    automated match to d2btia_
    protein/RNA complex

Details for d2jppa_

PDB Entry: 2jpp (more details)

PDB Description: structural basis of rsma/csra rna recognition: structure of rsme bound to the shine-dalgarno sequence of hcna mrna
PDB Compounds: (A:) Translational repressor

SCOPe Domain Sequences for d2jppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jppa_ b.151.1.1 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqa

SCOPe Domain Coordinates for d2jppa_:

Click to download the PDB-style file with coordinates for d2jppa_.
(The format of our PDB-style files is described here.)

Timeline for d2jppa_:

2825133
d2jppa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2jppb_