Lineage for d2jp2a_ (2jp2 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799493Domain d2jp2a_: 2jp2 A: [242259]
    automated match to d1xodb_

Details for d2jp2a_

PDB Entry: 2jp2 (more details)

PDB Description: solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
PDB Compounds: (A:) Sprouty-related, EVH1 domain-containing protein 2

SCOPe Domain Sequences for d2jp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jp2a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmteethpdddsyivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgfl
ihgerqkdklvvlecyvrkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgvrka
iedlie

SCOPe Domain Coordinates for d2jp2a_:

Click to download the PDB-style file with coordinates for d2jp2a_.
(The format of our PDB-style files is described here.)

Timeline for d2jp2a_: