Lineage for d2jm5a1 (2jm5 A:3-134)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
multihelical; consists of two all-alpha subdomains
contains a 4-helical bundle with left-handed twist and up-and-down topologySuperfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) 
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) 
Protein Regulator of G-protein signaling 18, RGS18 [140750] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140751] (1 PDB entry)
Uniprot Q9NS28 75-206
Domain d2jm5a1: 2jm5 A:3-134 [138355]
Other proteins in same PDB: d2jm5a2
Details for d2jm5a1
PDB Entry: 2jm5 (more details)
PDB Description: solution structure of the rgs domain from human rgs18
PDB Compounds: (A:) Regulator of G-protein signaling 18SCOPe Domain Sequences for d2jm5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp
SCOPe Domain Coordinates for d2jm5a1:
Click to download the PDB-style file with coordinates for d2jm5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jm5a1:
- d2jm5a1 first appeared in SCOP 1.73
- d2jm5a1 appears in SCOPe 2.06
- d2jm5a1 appears in the current release, SCOPe 2.08
View in 3D
