Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries) |
Domain d2jkwa_: 2jkw A: [166251] automated match to d1bqka_ complexed with cu |
PDB Entry: 2jkw (more details), 1.6 Å
SCOPe Domain Sequences for d2jkwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkwa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]} adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala algn
Timeline for d2jkwa_: