Lineage for d2jkwa_ (2jkw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2770994Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries)
  8. 2770995Domain d2jkwa_: 2jkw A: [166251]
    automated match to d1bqka_
    complexed with cu

Details for d2jkwa_

PDB Entry: 2jkw (more details), 1.6 Å

PDB Description: pseudoazurin m16f
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d2jkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkwa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d2jkwa_:

Click to download the PDB-style file with coordinates for d2jkwa_.
(The format of our PDB-style files is described here.)

Timeline for d2jkwa_: