Lineage for d2jk2b_ (2jk2 B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (20 species) 
Species Human (Homo sapiens) [TaxId:9606] [51355] (5 PDB entries) 
Domain d2jk2b_: 2jk2 B: [148135]
automated match to d1htia_
Details for d2jk2b_
PDB Entry: 2jk2 (more details), 1.7 Å
PDB Description: structural basis of human triosephosphate isomerase deficiency. crystal structure of the wild type enzyme.
PDB Compounds: (B:) triosephosphate isomeraseSCOPe Domain Sequences for d2jk2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jk2b_ c.1.1.1 (B:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq
SCOPe Domain Coordinates for d2jk2b_:
Click to download the PDB-style file with coordinates for d2jk2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jk2b_:
- d2jk2b_ first appeared in SCOP 1.75, called d2jk2b1
- d2jk2b_ appears in SCOPe 2.03
- d2jk2b_ appears in SCOPe 2.05
- d2jk2b_ appears in the current release, SCOPe 2.08
View in 3D
