Lineage for d2jiga_ (2jig A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) 
Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
Pfam PF13640; PubMed 16782814
Protein P4H-1 [254393] (1 species) Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [254829] (1 PDB entry) 
Domain d2jiga_: 2jig A: [242223]
complexed with gol, pd2, so4, zn
Details for d2jiga_
PDB Entry: 2jig (more details), 1.85 Å
PDB Description: crystal structure of chlamydomonas reinhardtii prolyl-4 hydroxylase type i complexed with zinc and pyridine-2,4-dicarboxylate
PDB Compounds: (A:) prolyl-4 hydroxylaseSCOPe Domain Sequences for d2jiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiga_ b.82.2.15 (A:) P4H-1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eewrgevvhlswsprafllknflsdeecdyivekarpkmvkssvvdnesgksvdseirts
tgtwfakgedsviskiekrvaqvtmiplenheglqvlhyhdgqkyephydyfhdpvnagp
ehggqrvvtmlmylttveeggetvlpnaeqkvtgdgwsecakrglavkpikgdalmfysl
kpdgsndpaslhgscptlkgdkwsatkwihvapigg
SCOPe Domain Coordinates for d2jiga_:
Click to download the PDB-style file with coordinates for d2jiga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jiga_:
- d2jiga_ is new in SCOPe 2.04-stable
- d2jiga_ appears in SCOPe 2.05
- d2jiga_ appears in the current release, SCOPe 2.08
View in 3D
