Lineage for d2jhza_ (2jhz A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) 
Protein automated matches [190534] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187499] (10 PDB entries) 
Domain d2jhza_: 2jhz A: [166203]
automated match to d1kmta_
mutant
Details for d2jhza_
PDB Entry: 2jhz (more details), 2.2 Å
PDB Description: crystal structure of rhogdi e155s, e157s mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1SCOPe Domain Sequences for d2jhza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhza_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraesysfltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw
SCOPe Domain Coordinates for d2jhza_:
Click to download the PDB-style file with coordinates for d2jhza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jhza_:
- d2jhza_ first appeared in SCOPe 2.01
- d2jhza_ appears in SCOPe 2.05
- d2jhza_ appears in SCOPe 2.07
- d2jhza_ appears in the current release, SCOPe 2.08
View in 3D
