Lineage for d2jhza_ (2jhz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770659Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1770714Protein automated matches [190534] (2 species)
    not a true protein
  7. 1770717Species Human (Homo sapiens) [TaxId:9606] [187499] (9 PDB entries)
  8. 1770727Domain d2jhza_: 2jhz A: [166203]
    automated match to d1kmta_
    mutant

Details for d2jhza_

PDB Entry: 2jhz (more details), 2.2 Å

PDB Description: crystal structure of rhogdi e155s, e157s mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhza_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraesysfltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhza_:

Click to download the PDB-style file with coordinates for d2jhza_.
(The format of our PDB-style files is described here.)

Timeline for d2jhza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jhzb_