| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
| Protein automated matches [190540] (4 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [188459] (1 PDB entry) |
| Domain d2jhqa_: 2jhq A: [166195] automated match to d1lqja_ complexed with cl |
PDB Entry: 2jhq (more details), 1.5 Å
SCOPe Domain Sequences for d2jhqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhqa_ c.18.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvilgq
dpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvllln
tvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrhhvl
maphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles
Timeline for d2jhqa_: