Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (2 proteins) this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain |
Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species) |
Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries) |
Domain d2jf2a_: 2jf2 A: [138289] automated match to d1lxa__ complexed with edo, peg |
PDB Entry: 2jf2 (more details), 1.8 Å
SCOPe Domain Sequences for d2jf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jf2a_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} gsmidksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigr dneiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllm inahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgva qdvppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiae laetypevkaftdffarstrglir
Timeline for d2jf2a_: