Lineage for d2jf2a_ (2jf2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2813834Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (2 proteins)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 2813835Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 2813836Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)
  8. 2813838Domain d2jf2a_: 2jf2 A: [138289]
    automated match to d1lxa__
    complexed with edo, peg

Details for d2jf2a_

PDB Entry: 2jf2 (more details), 1.8 Å

PDB Description: Nucleotide substrate binding by UDP-N-acetylglucosamine acyltransferase
PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d2jf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jf2a_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
gsmidksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigr
dneiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllm
inahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgva
qdvppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiae
laetypevkaftdffarstrglir

SCOPe Domain Coordinates for d2jf2a_:

Click to download the PDB-style file with coordinates for d2jf2a_.
(The format of our PDB-style files is described here.)

Timeline for d2jf2a_: