Lineage for d2je9a_ (2je9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780474Protein automated matches [190035] (21 species)
    not a true protein
  7. 1780624Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)
  8. 1780629Domain d2je9a_: 2je9 A: [198109]
    automated match to d2je9d_
    complexed with ca, mn, so4, xmm

Details for d2je9a_

PDB Entry: 2je9 (more details), 2.1 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin complexed with 5-bromo-4-chloro-3-indolyl-a-d-mannose
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d2je9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je9a_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
iadenslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2je9a_:

Click to download the PDB-style file with coordinates for d2je9a_.
(The format of our PDB-style files is described here.)

Timeline for d2je9a_: