Lineage for d2j9va_ (2j9v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2314120Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) (S)
  5. 2314121Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins)
    C-terminal part of Pfam PF03997
  6. 2314131Protein automated matches [190730] (1 species)
    not a true protein
  7. 2314132Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187898] (2 PDB entries)
  8. 2314135Domain d2j9va_: 2j9v A: [138157]
    automated match to d2g3ka1

Details for d2j9va_

PDB Entry: 2j9v (more details), 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus
PDB Compounds: (A:) vacuolar protein sorting-associated protein 28

SCOPe Domain Sequences for d2j9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9va_ a.24.28.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhhmfnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrskli
dwivrinklsigdtltetqirellfdlelayksfyalld

SCOPe Domain Coordinates for d2j9va_:

Click to download the PDB-style file with coordinates for d2j9va_.
(The format of our PDB-style files is described here.)

Timeline for d2j9va_: