Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (1 family) contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
Protein Vacuolar protein-sorting-associated protein 36, VPS36 [161173] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161174] (1 PDB entry) Uniprot Q06696 115-161 |
Domain d2j9ub1: 2j9u B:115-161 [145677] Other proteins in same PDB: d2j9ua_, d2j9uc_, d2j9ud_ complexed with zn |
PDB Entry: 2j9u (more details), 2 Å
SCOPe Domain Sequences for d2j9ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc
Timeline for d2j9ub1: