Lineage for d2j9la1 (2j9l A:578-746)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901515Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1901516Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1901517Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1901534Protein Chloride channel protein 5, ClC-5 [160174] (1 species)
  7. 1901535Species Human (Homo sapiens) [TaxId:9606] [160175] (1 PDB entry)
    Uniprot P51795 578-746
  8. 1901536Domain d2j9la1: 2j9l A:578-746 [147943]
    Other proteins in same PDB: d2j9lb_, d2j9lc_, d2j9ld_, d2j9le_, d2j9lf_
    complexed with atp, cl

Details for d2j9la1

PDB Entry: 2j9l (more details), 2.3 Å

PDB Description: cytoplasmic domain of the human chloride transporter clc-5 in complex with atp
PDB Compounds: (A:) chloride channel protein 5

SCOPe Domain Sequences for d2j9la1:

Sequence, based on SEQRES records: (download)

>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme
ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqdpdsilfn

Sequence, based on observed residues (ATOM records): (download)

>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme
ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanfn

SCOPe Domain Coordinates for d2j9la1:

Click to download the PDB-style file with coordinates for d2j9la1.
(The format of our PDB-style files is described here.)

Timeline for d2j9la1: