Lineage for d2j91b_ (2j91 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. Protein automated matches [190621] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [256256] (5 PDB entries)
  8. Domain d2j91b_: 2j91 B: [343692]
    automated match to d5eyva_
    complexed with amp, cl, gol

Details for d2j91b_

PDB Entry: 2j91 (more details), 1.8 Å

PDB Description: crystal structure of human adenylosuccinate lyase in complex with amp
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d2j91b_:

Sequence, based on SEQRES records: (download)

>d2j91b_ a.127.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqire
mksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliil
rnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlq
nlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtyt
rkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserc
cslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvv
ypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndli
eriqvdayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvkae

Sequence, based on observed residues (ATOM records): (download)

>d2j91b_ a.127.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqire
mksnlenidfkmaaeeekrlrhdvmahvhtfghccaagiihlgatscyvgdntdliilrn
aldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnl
krvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrk
vdievlsvlaslgasvhkictdirllanlkemeepfmpykrnpmrserccslarhlmtlv
mdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrirq
elpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqvdayfsp
ihsqldhlldpssftgrasqqvqrfleeevypllkpyesvkae

SCOPe Domain Coordinates for d2j91b_ are not available.

Timeline for d2j91b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j91a_, d2j91c_, d2j91d_