| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (9 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries) |
| Domain d2j8dm_: 2j8d M: [147912] Other proteins in same PDB: d2j8dh1, d2j8dh2 automated match to d1ystm_ complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10 |
PDB Entry: 2j8d (more details), 2.07 Å
SCOPe Domain Sequences for d2j8dm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8dm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmapln
Timeline for d2j8dm_: