Lineage for d2j8dm_ (2j8d M:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457967Protein automated matches [190224] (5 species)
    not a true protein
  7. 1457979Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries)
  8. 1457989Domain d2j8dm_: 2j8d M: [147912]
    Other proteins in same PDB: d2j8dh1, d2j8dh2
    automated match to d1ystm_
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10

Details for d2j8dm_

PDB Entry: 2j8d (more details), 2.07 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the charge-separated state
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2j8dm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8dm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmapln

SCOPe Domain Coordinates for d2j8dm_:

Click to download the PDB-style file with coordinates for d2j8dm_.
(The format of our PDB-style files is described here.)

Timeline for d2j8dm_: