Lineage for d2j6ka_ (2j6k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393170Domain d2j6ka_: 2j6k A: [204962]
    automated match to d3i35a_
    complexed with na

Details for d2j6ka_

PDB Entry: 2j6k (more details), 2.77 Å

PDB Description: n-terminal sh3 domain of cms (cd2ap human homolog)
PDB Compounds: (A:) CD2-associated protein

SCOPe Domain Sequences for d2j6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ka_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik

SCOPe Domain Coordinates for d2j6ka_:

Click to download the PDB-style file with coordinates for d2j6ka_.
(The format of our PDB-style files is described here.)

Timeline for d2j6ka_: