Lineage for d2j6ba1 (2j6b A:1-109)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010898Fold d.321: STIV B116-like [143601] (1 superfamily)
    subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface
  4. 3010899Superfamily d.321.1: STIV B116-like [143602] (2 families) (S)
  5. 3010900Family d.321.1.1: STIV B116-like [143603] (3 proteins)
    automatically mapped to Pfam PF08960
  6. 3010901Protein Afv3-109 [143606] (1 species)
  7. 3010902Species Acidianus filamentous virus 1 [TaxId:235266] [143607] (2 PDB entries)
  8. 3010903Domain d2j6ba1: 2j6b A:1-109 [138078]

Details for d2j6ba1

PDB Entry: 2j6b (more details), 1.3 Å

PDB Description: crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses
PDB Compounds: (A:) afv3-109

SCOPe Domain Sequences for d2j6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ba1 d.321.1.1 (A:1-109) Afv3-109 {Acidianus filamentous virus 1 [TaxId: 235266]}
mlyilnsailplkpgeeytvkakeitiqeakelvtkeqftsaighqataellssilgvnv
pmnrvqikvthgdrilafmlkqrlpegvvvktteelekigyelwlfeiq

SCOPe Domain Coordinates for d2j6ba1:

Click to download the PDB-style file with coordinates for d2j6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ba1: