| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (43 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries) |
| Domain d2j3sa2: 2j3s A:2136-2236 [147861] Other proteins in same PDB: d2j3sb2 automated match to d2j3sa2 complexed with br, dio, gol |
PDB Entry: 2j3s (more details), 2.5 Å
SCOPe Domain Sequences for d2j3sa2:
Sequence, based on SEQRES records: (download)
>d2j3sa2 b.1.18.0 (A:2136-2236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gegrvkesitrrrrapsvanvgshcdlslkipeisiqdmtaqvtspsgktheaeivegen
htycirfvpaemgthtvsvkykgqhvpgspfqftvgplgeg
>d2j3sa2 b.1.18.0 (A:2136-2236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gegrvkesitrrrrapsvanvgshcdliqdmtaqvtspsgktheaeiycirfvpaemgth
tvsvkykgqhvpgspfqftvgplgeg
Timeline for d2j3sa2: