Lineage for d2j3sa2 (2j3s A:2149-2236)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524391Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 1524412Protein Filamin b [141025] (1 species)
  7. 1524413Species Human (Homo sapiens) [TaxId:9606] [141026] (18 PDB entries)
    Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192
  8. 1524415Domain d2j3sa2: 2j3s A:2149-2236 [147861]
    automatically matched to d2dlga1
    complexed with br, dio, gol

Details for d2j3sa2

PDB Entry: 2j3s (more details), 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2j3sa2:

Sequence, based on SEQRES records: (download)

>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
rapsvanvgshcdlslkipeisiqdmtaqvtspsgktheaeivegenhtycirfvpaemg
thtvsvkykgqhvpgspfqftvgplgeg

Sequence, based on observed residues (ATOM records): (download)

>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
rapsvanvgshcdliqdmtaqvtspsgktheaeiycirfvpaemgthtvsvkykgqhvpg
spfqftvgplgeg

SCOPe Domain Coordinates for d2j3sa2:

Click to download the PDB-style file with coordinates for d2j3sa2.
(The format of our PDB-style files is described here.)

Timeline for d2j3sa2:

1524415
d2j3sa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2j3sa1