Lineage for d2j3pb_ (2j3p B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543307Protein automated matches [190637] (2 species)
    not a true protein
  7. 1543319Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries)
  8. 1543321Domain d2j3pb_: 2j3p B: [193884]
    automated match to d2uusa_
    complexed with so4

Details for d2j3pb_

PDB Entry: 2j3p (more details), 1.4 Å

PDB Description: crystal structure of rat fgf1 at 1.4 a
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2j3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j3pb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqylamd
tegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygqk
ailflplpvssd

SCOPe Domain Coordinates for d2j3pb_:

Click to download the PDB-style file with coordinates for d2j3pb_.
(The format of our PDB-style files is described here.)

Timeline for d2j3pb_: