Lineage for d2j1qa2 (2j1q A:96-355)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581421Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2581485Protein automated matches [226885] (7 species)
    not a true protein
  7. 2581518Species Trypanosoma cruzi [TaxId:5693] [230886] (1 PDB entry)
  8. 2581519Domain d2j1qa2: 2j1q A:96-355 [230887]
    Other proteins in same PDB: d2j1qa1
    automated match to d1m15a2
    complexed with gol

Details for d2j1qa2

PDB Entry: 2j1q (more details), 1.9 Å

PDB Description: crystal structure of trypanosoma cruzi arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d2j1qa2:

Sequence, based on SEQRES records: (download)

>d2j1qa2 d.128.1.2 (A:96-355) automated matches {Trypanosoma cruzi [TaxId: 5693]}
sdkqppkdsgdlntfidvdpdkkyvistrvrcgrslegypfnpclkkqqyeemesrvkgq
lesmsgelrgkyypltgmtketqkqliddhflfkegdrflqaahackfwptgrgiyhnda
ktflvwvneedhlriismqkggnlkevfgrlvtavgvieekvkfsrddrlgfltfcptnl
gttirasvhiklpklgadrkkleevaakynlqvrgtagehsdspdgvydisnkrrlglse
yeavkemqdgilelikaees

Sequence, based on observed residues (ATOM records): (download)

>d2j1qa2 d.128.1.2 (A:96-355) automated matches {Trypanosoma cruzi [TaxId: 5693]}
sdkqppkdsgdlntfidvdpdkkyvistrvrcgrslegypfnpclkkqqyeemesrvkgq
lesmsgelrgkyypltgmtketqkqliddhflfkegdrflqaahackfwptgrgiyhnda
ktflvwvneedhlriismqkggnlkevfgrlvtavgvieekvkfsrddrlgfltfcptnl
gttirasvhiklprkkleevaakynlqvrgvydisnkrrlglseyeavkemqdgilelik
aees

SCOPe Domain Coordinates for d2j1qa2:

Click to download the PDB-style file with coordinates for d2j1qa2.
(The format of our PDB-style files is described here.)

Timeline for d2j1qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j1qa1