Lineage for d2j1qa1 (2j1q A:1-95)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
irregular array of 6 short helicesSuperfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) 
automatically mapped to Pfam PF02807Family a.83.1.0: automated matches [227170] (1 protein)
not a true familyProtein automated matches [226884] (9 species)
not a true protein
Species Trypanosoma cruzi [TaxId:5693] [230884] (1 PDB entry) 
Domain d2j1qa1: 2j1q A:1-95 [230885]
Other proteins in same PDB: d2j1qa2
automated match to d1m15a1
complexed with gol
Details for d2j1qa1
PDB Entry: 2j1q (more details), 1.9 Å
PDB Description: crystal structure of trypanosoma cruzi arginine kinase
PDB Compounds: (A:) arginine kinaseSCOPe Domain Sequences for d2j1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1qa1 a.83.1.0 (A:1-95) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masaevvskleaafaklqnasdchsllkkyltkevfdqlkgkqtkmgatlmdviqsgven
ldsgigvyapdaesytlfaalldpiiedyhkgfkp
SCOPe Domain Coordinates for d2j1qa1:
Click to download the PDB-style file with coordinates for d2j1qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j1qa1:
- d2j1qa1 first appeared in SCOPe 2.03
- d2j1qa1 appears in SCOPe 2.07
View in 3D
