Lineage for d2j05a_ (2j05 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393077Domain d2j05a_: 2j05 A: [198083]
    automated match to d2j05b_

Details for d2j05a_

PDB Entry: 2j05 (more details), 1.5 Å

PDB Description: crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution
PDB Compounds: (A:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d2j05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j05a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlve
evgr

SCOPe Domain Coordinates for d2j05a_:

Click to download the PDB-style file with coordinates for d2j05a_.
(The format of our PDB-style files is described here.)

Timeline for d2j05a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j05b_