Lineage for d2iy2a1 (2iy2 A:3-61)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) 
Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (2 proteins) Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species) Species Escherichia coli [TaxId:562] [110823] (6 PDB entries)
Uniprot P77202
Domain d2iy2a1: 2iy2 A:3-61 [147834]
automatically matched to d1v57a2
complexed with cd
Details for d2iy2a1
PDB Entry: 2iy2 (more details), 1.9 Å
PDB Description: crystal structure of the n-terminal dimer domain of e.coli dsbg
PDB Compounds: (A:) thiol disulfide interchange protein dsbgSCOPe Domain Sequences for d2iy2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy2a1 d.17.3.1 (A:3-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli [TaxId: 562]}
lpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
SCOPe Domain Coordinates for d2iy2a1:
Click to download the PDB-style file with coordinates for d2iy2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2iy2a1:
- d2iy2a1 first appeared in SCOP 1.75
- d2iy2a1 appears in SCOPe 2.02
- d2iy2a1 is called d2iy2a_ in SCOPe 2.04
- d2iy2a1 appears in the current release, SCOPe 2.08, called d2iy2a_
View in 3D
