Lineage for d2ixfa_ (2ixf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478533Protein automated matches [190723] (8 species)
    not a true protein
  7. 2478551Species Norway rat (Rattus norvegicus) [TaxId:10116] [187882] (4 PDB entries)
  8. 2478554Domain d2ixfa_: 2ixf A: [165732]
    automated match to d1jj7a_
    complexed with atp, gol, mg; mutant

Details for d2ixfa_

PDB Entry: 2ixf (more details), 2 Å

PDB Description: crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant)
PDB Compounds: (A:) antigen peptide transporter 1

SCOPe Domain Sequences for d2ixfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixfa_ c.37.1.12 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
splsgslaplnmkglvkfqdvsfaypnhpnvqvlqgltftlypgkvtalvgpngsgkstv
aallqnlyqptggkvlldgeplvqydhhylhtqvaavgqepllfgrsfreniaygltrtp
tmeeitavamesgahdfisgfpqgydtevgetgnqlsggqrqavalaralirkprllild
qatsaldagnqlrvqrllyespewasrtvllithqlslaerahhilflkegsvceqgthl
qlmerggcyrsmvea

SCOPe Domain Coordinates for d2ixfa_:

Click to download the PDB-style file with coordinates for d2ixfa_.
(The format of our PDB-style files is described here.)

Timeline for d2ixfa_: