Lineage for d2ivxa2 (2ivx A:150-262)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1274245Protein Cyclin-T2 [158593] (1 species)
  7. 1274246Species Human (Homo sapiens) [TaxId:9606] [158594] (1 PDB entry)
    Uniprot O60583 150-262! Uniprot O60583 7-149
  8. 1274248Domain d2ivxa2: 2ivx A:150-262 [147814]
    complexed with edo

Details for d2ivxa2

PDB Entry: 2ivx (more details), 1.8 Å

PDB Description: crystal structure of human cyclin t2 at 1.8 a resolution
PDB Compounds: (A:) cyclin-t2

SCOPe Domain Sequences for d2ivxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]}
ehphtdvvkctqlvraskdlaqtsyfmatnslhlttfclqykptviacvcihlackwsnw
eipvstdgkhwweyvdptvtlelldeltheflqilektpnrlkkirnwranqa

SCOPe Domain Coordinates for d2ivxa2:

Click to download the PDB-style file with coordinates for d2ivxa2.
(The format of our PDB-style files is described here.)

Timeline for d2ivxa2:

1274248
d2ivxa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ivxa1