Lineage for d2iu5a1 (2iu5 A:1-71)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692494Protein Transcriptional activator DhaS [158248] (1 species)
  7. 2692495Species Lactococcus lactis [TaxId:1358] [158249] (1 PDB entry)
    Uniprot Q9CIV9 8-78
  8. 2692496Domain d2iu5a1: 2iu5 A:1-71 [147801]
    Other proteins in same PDB: d2iu5a2, d2iu5b2, d2iu5b3

Details for d2iu5a1

PDB Entry: 2iu5 (more details), 1.6 Å

PDB Description: dihydroxyacetone kinase operon activator dhas
PDB Compounds: (A:) hth-type dhaklm operon transcriptional activator dhas

SCOPe Domain Sequences for d2iu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]}
meksiitqkiiakafkdlmqsnayhqisvsdimqtakirrqtfynyfqnqeellswifen
dfaelindnsd

SCOPe Domain Coordinates for d2iu5a1:

Click to download the PDB-style file with coordinates for d2iu5a1.
(The format of our PDB-style files is described here.)

Timeline for d2iu5a1:

2692496
d2iu5a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2iu5a2