Lineage for d2itba1 (2itb A:3-201)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.7: MiaE-like [158405] (1 protein)
Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species) Species Pseudomonas putida [TaxId:303] [158407] (4 PDB entries)
Uniprot Q88KV1 3-201
Domain d2itba1: 2itb A:3-201 [147793]
complexed with edo, fe, per, unl
Details for d2itba1
PDB Entry: 2itb (more details), 2.05 Å
PDB Description: crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution
PDB Compounds: (A:) TRNA-(Ms(2)io(6)a)-hydroxylase, putativeSCOPe Domain Sequences for d2itba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itba1 a.25.1.7 (A:3-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
lipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmm
srlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafie
arscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraae
meliqspdqelrfhsgipq
SCOPe Domain Coordinates for d2itba1:
Click to download the PDB-style file with coordinates for d2itba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2itba1:
- d2itba1 first appeared in SCOP 1.75
- d2itba1 appears in SCOPe 2.07
View in 3D
