Lineage for d2iqxc_ (2iqx C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046220Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2046221Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2046222Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2046243Protein automated matches [190720] (4 species)
    not a true protein
  7. 2046248Species Norway rat (Rattus norvegicus) [TaxId:10116] [187873] (3 PDB entries)
  8. 2046252Domain d2iqxc_: 2iqx C: [165651]
    automated match to d1b7aa_
    complexed with ope; mutant

Details for d2iqxc_

PDB Entry: 2iqx (more details), 2.2 Å

PDB Description: rat phosphatidylethanolamine-binding protein containing the s153e mutation in the complex with o-phosphorylethanolamine
PDB Compounds: (C:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d2iqxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iqxc_ b.17.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
maadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldp
gklytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhry
vwlvyeqeqplncdepilsnksgdnrgkfkveefrkkyhlgapvagtcfqaewddsvpkl
hdqlag

SCOPe Domain Coordinates for d2iqxc_:

Click to download the PDB-style file with coordinates for d2iqxc_.
(The format of our PDB-style files is described here.)

Timeline for d2iqxc_: