Class b: All beta proteins [48724] (177 folds) |
Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) |
Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
Protein automated matches [190720] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187873] (3 PDB entries) |
Domain d2iqxc_: 2iqx C: [165651] automated match to d1b7aa_ complexed with ope; mutant |
PDB Entry: 2iqx (more details), 2.2 Å
SCOPe Domain Sequences for d2iqxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iqxc_ b.17.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} maadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldp gklytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhry vwlvyeqeqplncdepilsnksgdnrgkfkveefrkkyhlgapvagtcfqaewddsvpkl hdqlag
Timeline for d2iqxc_: