Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries) |
Domain d2iphb_: 2iph B: [304073] automated match to d2fyqa_ complexed with lgg |
PDB Entry: 2iph (more details), 1.75 Å
SCOPe Domain Sequences for d2iphb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iphb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 37129]} tlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfskk irpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt ganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqasegettl
Timeline for d2iphb_: