Lineage for d2iphb_ (2iph B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798057Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries)
  8. 2798077Domain d2iphb_: 2iph B: [304073]
    automated match to d2fyqa_
    complexed with lgg

Details for d2iphb_

PDB Entry: 2iph (more details), 1.75 Å

PDB Description: X-ray Structure at 1.75 A Resolution of a Norovirus Protease Linked to an Active Site Directed Peptide Inhibitor
PDB Compounds: (B:) Thiol protease P3C

SCOPe Domain Sequences for d2iphb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iphb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 37129]}
tlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfskk
irpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqasegettl

SCOPe Domain Coordinates for d2iphb_:

Click to download the PDB-style file with coordinates for d2iphb_.
(The format of our PDB-style files is described here.)

Timeline for d2iphb_: