Lineage for d2io5b_ (2io5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698297Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries)
  8. 2698340Domain d2io5b_: 2io5 B: [161465]
    Other proteins in same PDB: d2io5a1, d2io5c_
    automated match to d1kx5a_

Details for d2io5b_

PDB Entry: 2io5 (more details), 2.7 Å

PDB Description: Crystal structure of the CIA- histone H3-H4 complex
PDB Compounds: (B:) Histone H3.1

SCOPe Domain Sequences for d2io5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io5b_ a.22.1.1 (B:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
mpkdiqlarrirgera

SCOPe Domain Coordinates for d2io5b_:

Click to download the PDB-style file with coordinates for d2io5b_.
(The format of our PDB-style files is described here.)

Timeline for d2io5b_: