Lineage for d2imta_ (2imt A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021546Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 3021551Domain d2imta_: 2imt A: [204828]
    automated match to d4aq3b_
    complexed with zn

Details for d2imta_

PDB Entry: 2imt (more details), 1.49 Å

PDB Description: the x-ray structure of a bak homodimer reveals an inhibitory zinc binding site
PDB Compounds: (A:) Apoptosis regulator BAK

SCOPe Domain Sequences for d2imta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imta_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlai
igddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlal
hvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaalnl

SCOPe Domain Coordinates for d2imta_:

Click to download the PDB-style file with coordinates for d2imta_.
(The format of our PDB-style files is described here.)

Timeline for d2imta_: