Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) |
Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
Protein Hypothetical transcriptional regulator YurK [160407] (1 species) |
Species Bacillus subtilis [TaxId:1423] [160408] (1 PDB entry) Uniprot O32152 86-238 |
Domain d2ikka1: 2ikk A:101-238 [147721] Other proteins in same PDB: d2ikka2, d2ikkb2, d2ikkb3 complexed with so4 |
PDB Entry: 2ikk (more details), 1.8 Å
SCOPe Domain Sequences for d2ikka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ikka1 d.190.1.2 (A:101-238) Hypothetical transcriptional regulator YurK {Bacillus subtilis [TaxId: 1423]} hhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfpgidtfi adgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaftsndqp iycslflmhtnrvtftin
Timeline for d2ikka1: