Lineage for d2ikka1 (2ikk A:101-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005731Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 3005746Protein Hypothetical transcriptional regulator YurK [160407] (1 species)
  7. 3005747Species Bacillus subtilis [TaxId:1423] [160408] (1 PDB entry)
    Uniprot O32152 86-238
  8. 3005748Domain d2ikka1: 2ikk A:101-238 [147721]
    Other proteins in same PDB: d2ikka2, d2ikkb2, d2ikkb3
    complexed with so4

Details for d2ikka1

PDB Entry: 2ikk (more details), 1.8 Å

PDB Description: Structural Genomics, the crystal structure of the C-terminal domain of Yurk from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) Hypothetical transcriptional regulator yurK

SCOPe Domain Sequences for d2ikka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ikka1 d.190.1.2 (A:101-238) Hypothetical transcriptional regulator YurK {Bacillus subtilis [TaxId: 1423]}
hhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfpgidtfi
adgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaftsndqp
iycslflmhtnrvtftin

SCOPe Domain Coordinates for d2ikka1:

Click to download the PDB-style file with coordinates for d2ikka1.
(The format of our PDB-style files is described here.)

Timeline for d2ikka1:

3005748
d2ikka1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ikka2