Lineage for d2ikba1 (2ikb A:1-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926468Family d.2.1.9: NMB1012-like [159827] (3 proteins)
    Pfam PF05838; predicted lysozyme (DUF847)
  6. 2926469Protein Hypothetical protein NMB1012 [159828] (1 species)
  7. 2926470Species Neisseria meningitidis [TaxId:487] [159829] (2 PDB entries)
    Uniprot Q7DDI9 1-153
  8. 2926471Domain d2ikba1: 2ikb A:1-163 [147717]
    Other proteins in same PDB: d2ikbb_, d2ikbc_, d2ikbd_

Details for d2ikba1

PDB Entry: 2ikb (more details), 1.7 Å

PDB Description: Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis
PDB Compounds: (A:) Hypothetical protein NMB1012

SCOPe Domain Sequences for d2ikba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ikba1 d.2.1.9 (A:1-163) Hypothetical protein NMB1012 {Neisseria meningitidis [TaxId: 487]}
msdkfnqfinrvlsheggyanhpkdpggetnwgitkrtaqangyngsmramtreqaisiy
rkafweryradqmpeavafqffdacvnhgygnaarmlqraagvpddgvigavslkainsl
pendlllrfnaerlvfytklgtftsfgkgwvrrvaqnlihasa

SCOPe Domain Coordinates for d2ikba1:

Click to download the PDB-style file with coordinates for d2ikba1.
(The format of our PDB-style files is described here.)

Timeline for d2ikba1: