Lineage for d2ijoa_ (2ijo A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039002Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 3039003Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 3039004Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)
  6. 3039010Protein automated matches [310851] (1 species)
    not a true protein
  7. 3039011Species West Nile virus [TaxId:11082] [311209] (3 PDB entries)
  8. 3039015Domain d2ijoa_: 2ijo A: [287879]
    Other proteins in same PDB: d2ijob1, d2ijoi_
    automated match to d2fp7a_

Details for d2ijoa_

PDB Entry: 2ijo (more details), 2.3 Å

PDB Description: crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d2ijoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijoa_ g.96.1.1 (A:) automated matches {West Nile virus [TaxId: 11082]}
stdmwiertadiswesdaeitgsservdvrldddgnfqlmn

SCOPe Domain Coordinates for d2ijoa_:

Click to download the PDB-style file with coordinates for d2ijoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ijoa_: