Lineage for d2ij0c1 (2ij0 C:1-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512530Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1512558Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)
  8. 1512569Domain d2ij0c1: 2ij0 C:1-117 [145525]
    Other proteins in same PDB: d2ij0a1, d2ij0a2, d2ij0b1, d2ij0b2

Details for d2ij0c1

PDB Entry: 2ij0 (more details), 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
PDB Compounds: (C:) penultimate affinity-matured variant of hVbeta 2.1, D10

SCOPe Domain Sequences for d2ij0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gavvsqhpsmvivksgtsvkiecrsldtnihtmfwyrqfpkqslmlmatshqgfnaiyeq
gvvkdkflinhasptlstltvtsahpedsgfyvcsalagsgsstdtqyfgpgtqltvl

SCOPe Domain Coordinates for d2ij0c1:

Click to download the PDB-style file with coordinates for d2ij0c1.
(The format of our PDB-style files is described here.)

Timeline for d2ij0c1: