Lineage for d2ii6a_ (2ii6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876907Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1876908Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) (S)
  5. 1877318Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 1877319Protein Alpha-2,3/2,6-sialyltransferase/sialidase [142774] (1 species)
  7. 1877320Species Pasteurella multocida [TaxId:747] [142775] (12 PDB entries)
    Uniprot Q15KI8 26-412
  8. 1877323Domain d2ii6a_: 2ii6 A: [165554]
    automated match to d2ex0a1
    complexed with c5p; mutant

Details for d2ii6a_

PDB Entry: 2ii6 (more details), 1.75 Å

PDB Description: crystal structure of pasteurella multocida sialyltransferase d141n mutant in open conformation with cmp bound
PDB Compounds: (A:) alpha-2,3/2,6-sialyltransferase/sialidase

SCOPe Domain Sequences for d2ii6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ii6a_ c.87.1.9 (A:) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]}
mktitlyldpaslpalnqlmdftqnnedkthprifglsrfkipdniitqyqnihfvelkd
nrptealftildqypgnielnihlniahsvqlirpilayrfkhldrvsiqqlnlydngsm
eyvdlekeenkdisaeikqaekqlshylltgkikfdnptiaryvwqsafpvkyhflstdy
fekaeflqplkeylaenyqkmdwtayqqltpeqqafyltlvgfndevkqslevqqakfif
tgtttwegntdvreyyaqqqlnllnhftqaegdlfigdhykiyfkghprggeindyilnn
aknitnipanisfevlmmtgllpdkvggvasslyfslpkekishiiftsnkqvkskedal
nnpyvkvmrrlgiidesqvifwdslkqlgggle

SCOPe Domain Coordinates for d2ii6a_:

Click to download the PDB-style file with coordinates for d2ii6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ii6a_: