Lineage for d2ihr1_ (2ihr 1:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1695015Fold e.38: Release factor [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 1695016Superfamily e.38.1: Release factor [75620] (2 families) (S)
  5. 1695029Family e.38.1.0: automated matches [191461] (1 protein)
    not a true family
  6. 1695030Protein automated matches [190712] (3 species)
    not a true protein
  7. 1695036Species Thermus thermophilus [TaxId:274] [187861] (3 PDB entries)
  8. 1695037Domain d2ihr1_: 2ihr 1: [165549]
    automated match to d1gqea_

Details for d2ihr1_

PDB Entry: 2ihr (more details), 2.5 Å

PDB Description: RF2 of Thermus thermophilus
PDB Compounds: (1:) Peptide chain release factor 2

SCOPe Domain Sequences for d2ihr1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihr1_ e.38.1.0 (1:) automated matches {Thermus thermophilus [TaxId: 274]}
laqrleglggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrsl
esdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgag
gteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeag
vhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvntt
dsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpi
ewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr

SCOPe Domain Coordinates for d2ihr1_:

Click to download the PDB-style file with coordinates for d2ihr1_.
(The format of our PDB-style files is described here.)

Timeline for d2ihr1_: