![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
![]() | Protein automated matches [254483] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255237] (31 PDB entries) |
![]() | Domain d2ihma2: 2ihm A:231-289 [242124] Other proteins in same PDB: d2ihma1, d2ihma3, d2ihmb1, d2ihmb3 automated match to d1jmsa3 protein/DNA complex; complexed with d3t, mg, na |
PDB Entry: 2ihm (more details), 2.4 Å
SCOPe Domain Sequences for d2ihma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihma2 a.60.12.0 (A:231-289) automated matches {Mouse (Mus musculus) [TaxId: 10090]} seryqtmklftqvfgvgvktanrwyqeglrtldelreqpqrltqqqkaglqyyqdlstp
Timeline for d2ihma2: